PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010908787.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 681aa    MW: 77071.8 Da    PI: 6.0393
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010908787.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.63.9e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatgkd++v 
  XP_010908787.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATQAGYWKATGKDRKVS 99 
                     79****************************.99**************95334455777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  XP_010908787.1 100 S-QRRAVGTKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                     9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-644156IPR003441NAC domain
PROSITE profilePS5100561.7096156IPR003441NAC domain
PfamPF023651.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MAPVTLPPGF RFHPTDEELV AYYLKRKING RKIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATQAGYWK ATGKDRKVSS QRRAVGTKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDEKECET ASGLQDAYAL CRIFKKSAPG PKIIEHYGAP YEEHSEWMSN  180
DRSPTVDLSS DGRGEDLDSC AYPFPRGTCS SEMIHGASFN ASASIDSKWM QFLNEETFAS  240
SSSFYHLPSF SYVPSKVDVA SDCARLQHTL SLPPLETEDF PQLDLADSKI LHSGRLQGNI  300
NEVDILQEIL SVASASQQLI NNSGYPDIWA GSNYHLDEFS CLLDFEVDRK TEGMHFSPMD  360
GMGSSRSMTK SCEAEEPTKL IEICDLEEEF KNEKGAENLK GVKILNNELI EITMEGQRST  420
PVDSTPGHQV GETADAEGEA NPSTSSPDLR NIDNKPILSP SQPDDFALDF MDIQPLGLYQ  480
DDHDNSARAS TPTFEVYEKV EVKHGLFISS SGVAETFFHH VEPSKKISFH LNPMVMQDVV  540
ERFEFPTKDR GRFSFFSRFK AFIQEKLLGK ISMKAWGRSF IGDESVNGML QIAAVLLTSC  600
MYFGEVSQQA NRRKHYFSKG QMMNAKREGG YLDGLKKVKK VDEKNIWFPT VRGRRIGSMI  660
LNAKWSFLTA AFAFYASKLT H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-55116212171NAC domain-containing protein 19
4dul_A1e-55116212171NAC domain-containing protein 19
1ut7_B1e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_A1e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_B1e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_A1e-55116212171NO APICAL MERISTEM PROTEIN
3swp_D1e-55116215174NAC domain-containing protein 19
3swp_C1e-55116215174NAC domain-containing protein 19
3swp_B1e-55116215174NAC domain-containing protein 19
3swp_A1e-55116215174NAC domain-containing protein 19
3swm_D1e-55116215174NAC domain-containing protein 19
3swm_C1e-55116215174NAC domain-containing protein 19
3swm_B1e-55116215174NAC domain-containing protein 19
3swm_A1e-55116215174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908787.10.0PREDICTED: NAC domain-containing protein 86-like isoform X1
SwissprotA4VCM01e-99NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4A6N60.0K4A6N6_SETIT; Uncharacterized protein
STRINGSi034541m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-133NAC domain containing protein 28